PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10037756
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRAS
Protein Properties Length: 459aa    MW: 51775.5 Da    PI: 6.2493
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10037756genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS262.31.7e-80934562374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalkl..fsevsPilkfsh 95 
                   +lLle+Ae v+ gd   a+++L++   ++sp+g+p+qRl++y+ +AL+ r+ ++  +++      +++e++   +  + ++++  f+   P+  +++
  Lus10037756  93 AQLLLEAAEKVARGDS--AETFLENCDLMSSPSGTPIQRLVFYYSRALRVRIGQEIGGIAT---KDQSTEEDlyKVVMTPSFRFveFHRKIPFSPVAQ 185
                  699**********985..889********************************96666654...4444444422222333333368************ PP

         GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                  ++  q I+e ve+++++H++Df+i +G QW  L+qaLasR+ +   +l+iT+v+      k+ +e+ g+ L +fA+e+++p +f+v+++++l++l+ +
  Lus10037756 186 FAGIQSIVEHVEKSRKIHVVDFGIRNGHQWTILMQALASRKrRRVKHLKITAVAT---LGKHLIEQRGNMLLSFAQEMNLPCSFHVVMVHDLTELRRD 280
                  ****************************************966677*********...67999*********************************** PP

         GRAS 193 eLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErell 290
                  +++++p+Ea+aV   + + +l  e+v+    +d+v+++++sl P v+vv+e e++ ns+ F++rf+e++ + sa fd++e  ++r++e+ri  E +l+
  Lus10037756 281 HFEIEPEEAVAVLAEYIINTLT-EPVER---IDSVIRAIRSLYPAVMVVTEMEVNINSPVFVNRFVESFFFASAYFDCFEDCMARDEETRIYGESMLF 374
                  ***************9777776.44443...669**************************************************************** PP

         GRAS 291 greivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  g+  + vva e +    r+ ++  Wr  ++++G+ +++ls++   qa+l+++kv+ +   +++ + +sl+ gWk+ p++sv+aW+
  Lus10037756 375 GEGSKVVVAEERSI---RNMKADVWRVYFKRMGMMEAALSQSSLYQAELVVKKVPrWSQCTIDTDGKSLIVGWKGTPILSVTAWK 456
                  99988888877766...888899********************************9889*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098535.3666435IPR005202Transcription factor GRAS
PfamPF035145.8E-7893456IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MANKGILIPP PLCVDDFSTD DLDVYDITSF RHLLPQSTSS PARNVIPPRS AALSVEELVR  60
IAASKFILSH SNDSSFHLST TLSDSESESV ELAQLLLEAA EKVARGDSAE TFLENCDLMS  120
SPSGTPIQRL VFYYSRALRV RIGQEIGGIA TKDQSTEEDL YKVVMTPSFR FVEFHRKIPF  180
SPVAQFAGIQ SIVEHVEKSR KIHVVDFGIR NGHQWTILMQ ALASRKRRRV KHLKITAVAT  240
LGKHLIEQRG NMLLSFAQEM NLPCSFHVVM VHDLTELRRD HFEIEPEEAV AVLAEYIINT  300
LTEPVERIDS VIRAIRSLYP AVMVVTEMEV NINSPVFVNR FVESFFFASA YFDCFEDCMA  360
RDEETRIYGE SMLFGEGSKV VVAEERSIRN MKADVWRVYF KRMGMMEAAL SQSSLYQAEL  420
VVKKVPRWSQ CTIDTDGKSL IVGWKGTPIL SVTAWKFC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3712345636375GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224228RKRRR
2225229KRRRV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316032.11e-139hypothetical protein POPTR_0010s15350g
TrEMBLB9HWZ71e-139B9HWZ7_POPTR; Uncharacterized protein
STRINGPOPTR_0010s15350.11e-139(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.13e-41RGA-like 2